As described in the paper:
Contact:
shenyang@niddk.nih.gov;
bax@nih.gov
|
![]() |
What is CS-ROSETTA?
To date, interpretation of isotropic chemical shifts in structural terms is largely based on empirical correlations gained from the mining of protein chemical shifts deposited in the BMRB, in conjunction with the known corresponding 3D structures. Chemical-Shift-ROSETTA (CS-ROSETTA) is a robust protocol to exploit this relation for de novo protein structure generation, using as input parameters the 13CA, 13CB, 13C', 15N, 1HA and 1HN NMR chemical shifts. These shifts are generally available at the early stage of the traditional NMR structure determination procedure, prior to the collection and analysis of structural restraints. The CS-ROSETTA approach, as shown below, utilizes SPARTA-based selection of protein fragments from the PDB, in conjunction with a regular ROSETTA Monte Carlo assembly and relaxation procedure. Evaluation of 16 proteins, varying in size from 56 to 129 residues yielded full atom models that deviate by 0.7-1.8 angstrom backbone rnsd from the experimentally determined X-ray or NMR structures. The strategy also has been successfully applied in a blind manner a set of structural genomics targets with molecular weights up to 16 kDa, whose conventional NMR structure determination was conducted in parallel.
In addition, an alternative CS-ROSETTA fragment selection protocol is provided that improves robustness of the method for proteins with missing or erroneous NMR chemical shift input data. This strategy, which uses traditional Rosetta for pre-filtering of the fragment selection process, is demonstrated for two paramagnetic proteins and also for two proteins with solid-state NMR chemical shift assignments.

Contents
Preparation of input chemical shift table
Identification
and exclusion of flexible tails and loops
How to use CS-ROSETTA (with ROSETTA2.x)
Fragment selection
MFR
method
Hybrid method
Protein structure generation
Evaluation of CS-ROSETTA models
How to use CS-ROSETTA (with ROSETTA3.x)
How to select CS-ROSETTA models
Criteria for convergence and accepting
models
Number of models required
How to use CS-ROSETTA for symmetric homomultimers
Installation files (for Linux/Mac)
| Install.com | CS-ROSETTA installation C-shell script(last modified at 11/17/2009, version 1.01) |
| CSRosetta.tar.Z | CS-ROSETTA main package, scripts, examples (last modified at 11/17/2009, version 1.01) |
| PDBH.tar.Z | Database of PDB files, required by MFR/CS-ROSETTA |
| CS.tar.Z | Database of chemical shifts files, required by MFR/CS-ROSETTA |
| ANGLESS.tar.Z | Database of secondary structure classifications and ROSETTA-idealized backbone torsion angles, required by CS-ROSETTA |
| "Hybrid" database | New database (required for "hybrid" fragment selection method) |
| changeLog |
The current implementation of CS-ROSETTA requires the MFR program to perform fragment selection and the ROSETTA program to conduct the protein structure prediction. Therefore, before installing and using the CS-ROSETTA package, the newest NMRPipe (incl. the MFR modules stored in dyn.tar.Z, mfr.tar.Z, pdbH.tar.Z) (http://spin.niddk.nih.gov/NMRPipe) and ROSETTA programs (http://www.rosettacommons.org/software/) MUST to be installed, as well as other programs such as RCI (http://redpoll.pharmacy.ualberta.ca/download/rci/)and TALOS (http://spin.niddk.nih.gov/NMRPipe/talos/), which are used during data analysis.
Note: If your NMRPipe was obtained and installed before 07/2007, please email Frank Delaglio to request the newest NMRPipe package in order to run CS-ROSETTAInstallation of ROSETTA (2.3)
To install the ROSETTA2.x program, users need to (1) register for a license at http://www.rosettacommons.org/software/, (2) download (at least) the required packages (RosettaBundle-2.3.0.tgz and rosetta_fragments-2.3.0.tgz) to the installation directory (for example $ROSETTA_DIR), (3) uncompress RosettaBundle-2.3.0.tgz, all four generated sub-packages (with names of rosetta*.tgz) and rosetta_fragments-2.3.0.tgz, (4) go to the rosetta++ directory and type "make gcc" (for Linux installation) to compile the ROSETTA source codes. After successful compilation, an executable ROSETTA file with default name "rosetta.gcc" will be generated.
Use of the 'hybrid' fragment selection procedure requires a set of initial fragment candidates selected by the standard ROSETTA fragment selection procedure, which can be performed locally with a perl script make_fragments_2000.pl (modified from the script make_fragments.pl of the ROSETTA fragment package). To run this script, several other programs, such as PSI-BLAST, PSIPRED, JUFO, PROFphd and/or SAM, are required to be installed and properly configured. Please see here (ROSETTA website) for the details on how to properly install those required programs and use this script. (Note: a set of database files specifically prepared for the 'hybrid' fragment selection method are required and can be downloaded here)
Installation and using Rosetta3.x in CS-ROSETTA will be discussed in the later section.
Installation of CS-ROSETTA
Download all above files to the installation directory ($baseDir), type 'install.com' to start the installation. The correctly installed CS-ROSETTA program contains the following contents in the installation directory $baseDir:
|
./com |
CS-ROSETTA scripts directory |
|
Adjust_CS_Offset.com |
Add an offset to a given type of chemical shift |
|
bmrb2fasta.com |
Generate a FASTA sequence file from a BMRB chemical shift file |
|
bmrb2talos.com |
Convert a BMRB chemical shift file to TALOS-format |
|
correctCACB_D_effect.com |
Apply deuteration effect corrections for 13CA and 13CB chemical shifts |
|
cs2fasta.com |
Generate a FASTA sequence file from the header of a TALOS chemical shift table file |
|
csrosettaInit.com |
CS-ROSETTA initialization script |
|
extract_pdb.com |
Generate PDB full-atom coordinates files from a ROSETTA(2.x) silent output file |
|
extract_lowscore_decoys.py |
Python script to extract N lowest energy models from a ROSETTA silent output file to a new silent output file |
|
fasta2pdb.com |
Generate a 'dummy'-PDB file from a FASTA sequence file, which is required by MFR as the reference structure |
|
make_fragments_2000.pl |
Generate 2000 initial ROSETTA fragments (used by runCSRjob_hybrid.com for a hybrid fragment selection module procedure; modified from the original script in the ROSETTA_fragment package) |
|
mfr2rosetta.com |
Convert a typical MFR-format fragment file to ROSETTA(2.x) format |
|
mfr.tcl |
Modified MFR starting script from the original 'mfr.tcl' in NMRPipe, required by CS-ROSETTA |
|
mfr.com |
Conduct MFR fragments search |
|
paths.txt |
Template of "paths.txt" file for ROSETTA |
|
pdb2fasta.com |
Generate a FASTA sequence file from a PDB file |
|
pdbrms |
Calculate CA-rmsd for a set of PDB coordinates |
|
renumber_pdb.com |
Renumber sequence number for a PDB coordinate file |
|
rosetta2GDB.com |
Convert a ROSETTA(2.x) fragment file to a generic table file |
|
rosettaFrag2csFrag.com |
Apply chemical shift scoring for a set of ROSETTA fragment candidates |
|
runCSRjob.com |
Run MFR fragment search and prepare inputs for the next step of ROSETTA(2.x) fragment assembly |
|
runCSRjob_hybrid.com |
Run fragment search using a hybrid method and prepare inputs for the next step of ROSETTA(2.x) fragment assembly |
|
runRosetta.com |
Template of ROSETTA(2.x) starting script |
|
runCSRescore.com |
Re-score ROSETTA (2.x) full-atom models using experimental chemical shifts |
|
runRosettaRescore.com |
Extract and rescore segments from ROSETTA(2.x) full-atom models |
|
sparta |
Starting script for program SPARTA |
|
talos |
Starting script for program TALOS (a 'fast' C++ version) |
|
./PDBH |
Directory of PDB coordinates database |
|
./CS |
Directory of SPARTA-assigned chemical shifts database |
|
./ANGLESS |
Directory of secondary structure classification and ROSETTA-idealized backbone torsion angles database |
|
./src |
Directory of supporting programs |
|
SPARTA |
Directory for the chemical shifts prediction program SPARTA |
|
TALOS |
Directory for the backbone torsion angle prediction program TALOS (a 'fast' C++ version) |
|
mfr2rosetta |
Directory for a C++ program to convert MFR-format fragments to ROSETTA-format |
|
nnmake |
Directory for a Fortran program to generate the initial ROSETTA fragment candidates (modified from the original program in the ROSETTA_fragment package) |
|
pdbrms |
Directory for a C++ program to calculate RMSD value between two sets of PDB coordinates |
|
rosettaFrag2csFrag |
Directory for a C++ program to calculate chemical shift score for a set of ROSETTA fragment candidates |
|
./example |
Directory of a complete example for protein GB3 |
|
./input/gb3.* |
GB3 input experimental chemical shift table (.tab) and reference experimental structure (.pdb) |
|
./output_hybrid/ |
All sample output files for GB3 CS-ROSETTA runs using the 'hybrid' fragment selection |
|
./output_rosetta2/ |
All sample output files for GB3 CS-ROSETTA runs using the ROSETTA2.x |
|
./output_rosetta3/ |
All sample output files for GB3 CS-ROSETTA runs using the ROSETTA3.x |
|
./output_rosetta_FnD/ |
All sample output files for GB3 homodimer CS-ROSETTA runs using the ROSETTA2.3.0 |
|
runCSRtest.com |
Script to test CS-ROSETTA installation |
The initialization script csrosettaInit.com includes the definitions for all environmental variables required by CS-ROSETTA. Please check if the variables $rosettaDir and $csrosettaDir defined in csrosettaInit.com:
setenv rosettaDir /home/software/ROSETTA setenv csrosettaDir /home/software/CSROSETTA
are correctly configured according to the ROSETTA and CS-ROSETTA installation directories.
In order to use the package, users MUST first execute the above initialization script, for instance by adding the following command to their .cshrc file:
if (-e $baseDir/com/csrosettaInit.com) then
source $baseDir/com/csrosettaInit.com
endif
If the package is installed successfully and environmental variables are set up correctly, the script in the example directory (examples/runCSRTest.com) should work successfully.
Preparation of input chemical shift table
CS-ROSETTA utilizes the protein backbone 15N, 1HN, 1HA, 13CA, 13CB and 13C'
chemical shifts as inputs to search a structural database for best matched
fragments. The chemical shifts need to be in TALOS format, as defined at
http://spin.niddk.nih.gov/NMRPipe/talos/#preparing shifts, and contain ONLY
backbone 15N, 1HN, 1HA, 13C', 13CA and 13CB shifts. If starting from a standard
BMRB format chemical shift file, a C-shell script
$baseDir/com/brmb2talos.com can
be used to generate a TALOS-format chemical shift file using:
brmb2talos.com bmrbCS.str > inCS.tabAn example of the chemical shifts input format can also be found in the file $baseDir/examples/input/gb3.tab:
DATA SEQUENCE MQYKLVINGK TLKGETTTKA VDAETAEKAF KQYANDNGVD GVWTYDDATK
DATA SEQUENCE TFTVTE
VARS RESID RESNAME ATOMNAME SHIFT
FORMAT %4d %1s %4s %8.3f
1 M CA 54.519
1 M CB 29.320
1 M HA 4.189
2 Q C 174.318
2 Q CA 55.632
2 Q CB 30.865
2 Q HN 8.347
2 Q HA 5.109
2 Q N 123.775
...
Note that missing chemical shift data are allowed, but the amino acid sequence
shown in the header MUST be the full sequence of the protein and MUST start from
residue #1, CS-ROSETTA will generate protein structures with the sequence
defined in the header. Identification and exclusion of flexible tails and loops
Residues from the disordered tails and loops are identified from the input
chemical shifts and the criteria in the paper:
(1) S2 < 0.7 from the RCI analysis, and
(2) no "good" predictions using the program TALOS
It is recommended to excluded positively identified flexible residues in the N-
and C-terminal tails from the structure prediction by preparing a 'truncated'
input chemical shift table file that excludes data (both sequence and chemical
shifts) from those residues (Note that the rest residues must be re-numbered so
that the 'truncated' sequence start from residue #1). For long flexible loops,
it is advantageous to exclude all terms from the ROSETTA full-atom energy and
the chemical shifts rescoring (see details in
Evaluation of CS-ROSETTA models)
How to use CS-ROSETTA (with Rosetta2.x)
CS-ROSETTA has been designed to work in a black-box manner, and is supported by multiple C-shell/C++/python/perl scripts/programs. To use CS-ROSETTA for protein structure prediction, users can simply follow a three-step procedure:

For each step, the details are provided as following:
1.1 MFR method - runCSRjob.com
The script runCSRjob.com is the
master script to generate MFR fragment candidates. To use this script, an input
chemical shift filename MUST be specified in a command line such as:
runCSRjob.com inCS.tab
The following optional variables are hard-coded in script
runCSRjob.com:
set OUTPUT_DIR = rosetta set MFR_EXCL = "PDB1_ PDB2A PDB3X" set PDB_NAME = t000 set CHAIN = _ set TAG = aa set N_MODEL = 5000
where $OUTPUT_DIR is the output directory of the fragments and scripts for running ROSETTA (or the ROSETTA running directory), $MFR_EXCL is the list of the proteins with homologous sequence and known structural homologs to the target protein, which (for test purpose) users may wish to exclude from the MFR structural database prior to MFR fragment searching, $PDB_NAME and $CHAIN are the 4-letter and 1-letter dummy names indicating the protein name and chain ID, respectively, $TAG is a 2-letter dummy tag (used by ROSETTA), $N_MODEL is the total number of models to be predicted.
The output of running this script will be the MFR-selected 9-residue and 3-residue fragment candidates (with file names of $OUTPUT_DIR/$TAG$PDB_NAME$CHAIN09_05.200_v1_3 and $OUTPUT_DIR/$TAG$PDB_NAME$CHAIN03_05.200_v1_3, respectively), a FASTA sequence file ($OUTPUT_DIR/$PDB_NAME$CHAIN.fasta), a ROSETTA paths definition file ($OUTPUT_DIR/paths.txt) and a script file ($OUTPUT_DIR/runRosetta.com) for starting ROSETTA structure generation.
It is recommended for users to read through and understand this script, which will facilitate use of the MFR program and other supporting scripts, and solve any problems during the MFR search (for example, by checking the intermediate and log files). This script (1) checks input chemical shifts and prepares input files for the MFR program, (2) performs the MFR fragment search, (3) converts the selected fragments to ROSETTA format and (4) prepares inputs and script for running ROSETTA structure generation. In detail:
(1) Check input chemical shifts and Prepare MFR inputs
The current MFR program in NMRPipe requires a TALOS format chemical shift table file as input (see Section of "Preparing of chemical shift table"). A pre-check step will be performed first to check for possible chemical shift referencing problems and chemical shift errors/outliers. The chemical shifts with identified referencing problem, for example a 2.7ppm referencing offset for the 13CA chemical shifts, can be corrected by using:
Adjust_CS_Offset.com inCS.tab CA -2.7
A "reference PDB" coordinate file is needed to
provide the MFR program with the protein's amino acid sequence. For this
purpose, runCSRjob.com creates a
dummy "reference PDB" coordinate file from its FASTA sequence using:
fasta2pdb protein.fasta > dummy_ref.pdb
(2) Run MFR fragment search
The script
runCSRjob.com then conducts a MFR fragment search following a command
line of:
mfr.com -cs inCS.tab -ref ref.pdb -out out.tab -excl $MFR_EXCL >& log
where $MFR_EXCL is a list of protein names (without .pdb suffix) that users like to exclude from the MFR structural database prior to the fragment search. MFR fragment selection from searching the structural database is a time-consuming job (1-3 hours); the 'log' file can be used to check the progress.
(3) Convert fragments to ROSETTA format
The MFR-selected 9-residues and 3-residues fragment
candidates, generated after running the MFR fragment search, have file names
frag9.$PDB_NAME.mfr.tab and
frag3.$PDB_NAME.mfr.tab,
respectively. Script
mfr2rosetta.com can be utilized
to convert these fragments to standard ROSETTA format:
mfr2rosetta.com -mfr frag9.$PDB_NAME.mfr.tab -segLength 9 > frag9.$PDB_NAME.rosetta.tab mfr2rosetta.com -mfr frag3.$PDB_NAME.mfr.tab -segLength 3 > frag3.$PDB_NAME.rosetta.tab
(4) Prepare ROSETTA running package
runCSRjob.com generates at the last step a new directory (defined by variable $OUTPUT_DIR) and prepares the following required inputs and script for running ROSETTA fragment assembly and structure generation:
9-residues and 3-residues fragment files $TAG$PDB_NAME$CHAIN09_05.200_v1_3 and $TAG$PDB_NAME$CHAIN03_05.200_v1_3
FASTA sequence file $PDB_NAME$CHAIN.fasta
ROSETTA paths definition file paths.txt
starting script file runRosetta.com for ROSETTA structure generation
1.2 Hybrid method - runCSRjob_hybrid.com
For proteins with incompleted/imperfect chemical shift assignments, a hybrid
fragment selection method is recommended for selecting fragment candidates
[click
here to see the reference]. The script
runCSRjob_hybrid.com is the master script to generate fragment candidates
with the hybrid method. To use this script, an input chemical shift table file
(in TALOS format) MUST be specified in a command line such as:
runCSRjob_hybrid.com inCS.tab
The following variables are hard-coded in this script analogous to those in the
script runCSRjob.com.:
set OUTPUT_DIR = rosetta set PDB_NAME = t000 set CHAIN = _ set TAG = aa set N_MODEL = 5000
The output of running this script will be the 9-residue and 3-residue fragments (with file names of $OUTPUT_DIR/$TAG$PDB_NAME$CHAIN09_05.200_v1_3 and $OUTPUT_DIR/$TAG$PDB_NAME$CHAIN03_05.200_v1_3, respectively), a FASTA sequence file ($OUTPUT_DIR/$PDB_NAME$CHAIN.fasta), a ROSETTA paths definition file ($OUTPUT_DIR/paths.txt) and a script file ($OUTPUT_DIR/runRosetta.com) for starting ROSETTA structure generation.
This script (1) checks input chemical shifts, (2) performs a conventional ROSETTA fragment search for the initial fragment candidates, (3) performs a "MFR" fragment search for the final fragment candidates and (4) prepares inputs and script for running ROSETTA structure generation. In detail:
(1) Pre-check chemical shifts
Similar to the script runCSRjob.com, a pre-check step will be performed first to check for the possible chemical shift referencing problems and chemical shift errors/outliers. A FASTA sequence file (with filename of t000_.fasta by default) will be generated for the next step.
(2) Run initial ROSETTA fragment search
The script
runCSRjob_hybrid.com then conducts a "standard" ROSETTA fragment search
following a command line of:
make_fragments_2000.pl t000_.fasta >& make_fragments_2000.log
where make_fragments_2000.pl is a perl script to generate 2000 ROSETTA fragment candidates for each overlapped 3-residue and 9-residue target fragment. The output of running this command line will be two files: $TAG$PDB_NAME$CHAIN03_05.000_v1_3 and $TAG$PDB_NAME$CHAIN03_05.000_v1_3.
An option of "-nohoms" can be used in order to omit homologs (with a PSI-BLAST e-score < 0.05) from the search:
make_fragments_2000.pl -nohoms t000_.fasta >& make_fragments_2000.log
Note that running script make_fragments_2000.pl on the low profile computer may fail due to the requirement of massive memory space.
(3) Run "MFR" fragment search
The script
rosettaFrag2csFrag then will be used to calculate the chemical shift
scores for the above initial fragment candidates:
rosettaFrag2csFrag -rosetta $FRAG9_FNAME.tab -cs inCS2.tab -segLength 9 -out $FRAG9_FNAME.csScore.tab -noverb
where $FRAG9_FNAME is the filename of the initial ROSETTA fragment candidates, $inCS2.tab stands for the input secondary chemical shift table file prepared in step (1). The output of running this command line will be a new fragment candidate file $FRAG9_FNAME.csScore.tab containing a chemical shift score for each fragment candidate.
The final 200 fragment candidates with the best chemical shift scores are kept for each overlapped 3-residue and 9-residue target fragment.
(4) Prepare ROSETTA running package
Similar to the script
runCSRjob.com, the script
runCSRjob_hybrid.com generates at its last step a new directory (defined
by variable $OUTPUT_DIR) and
prepares the required inputs and script for running ROSETTA fragment assembly
and structure generation.
2. Protein structure generation - runRosetta.com
The script runRosetta.com
generated by running runCSRjob.com
or runCSRjob_hybrid.com can be
used to start the standard ROSETTA structure generation (fragment assembly and
full-atom relaxation). This script includes solely a standard ROSETTA command
line defining the inputs and parameters for fragment assembly and full-atom
relaxation
$rosetta $TAG $PDB_NAME $CHAIN -silent -output_silent -constant_seed -jran $rand -increase_cycles 10 -new_centroid_packing -abrelax -output_chi_silent -stringent_relax -vary_omega -omega_weight 0.5 -farlx -ex1 -ex2 -termini -short_range_hb_weight 0.50 -long_range_hb_weight 1.0 -no_filters -rg_reweight 0.5 -rsd_wt_helix 0.5 -rsd_wt_loop 0.5 -output_all -accept_all -do_farlx_checkpointing -relax_score_filter -record_irms_before_relax -acceptance_rate 1.0 -filter1a 10000 -filter1b 10000 -nstruct $N_MODEL
where $TAG, $PDB_NAME, $CHAIN (variables for protein identities) and $N_MODEL (total number of predicted models) are automatically replaced by their values defined in the script runCSRjob.com.
Typing runRosetta.com in the working directory (where the files of the selected fragment candidates, FASTA sequence and paths.txt are stored) will start the standard ROSETTA structure prediction. The output of the ROSETTA run is a so-called silent output file with name $TAG$PDB_NAME.out, which includes the scores and full-atom descriptions for all accepted models.
The ROSETTA fragment assembly and relaxation procedure is computationally demanding (on the order of 5-10 minutes per model). Therefore, use of computer clusters is highly recommended. In order to run multiple ROSETTA jobs in parallel for a given project, users can simply run the same script runRosetta.com for each 'parallel' job in the same working directory; ROSETTA will output the results from each job to a single silent output file.
3. Evaluation of CS-ROSETTA models - runCSrescore.com
A ROSETTA silent output file $TAG$PDB_NAME.out
contains a header in its first two lines (first line: the sequence information;
second line: definition of scores and values), and for each model, a score line
(which starts with "SCORE:") and the residue-specific description of this model.
An example ROSETTA silent output file is shown below:
SEQUENCE: MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE SCORE: score env pair vdw hs ss sheet cb rsigma hb_srbb hb_lrbb rg co contact rama bk_tot fa_atr fa_rep fa_sol h2o_sol hbsc fa_dun fa_intra fa_pair fa_plane fa_prob fa_h2o h2o_hb gsolt sasa omega_sc description SCORE: -116.07 -12.24 -1.62 0.31 -3.25 -72.74 0.34 15.99 -28.93 -18.75 -29.62 11.42 17.69 0.00 -13.19 -134.45 -165.57 7.34 84.55 0.00 -3.13 22.82 0.07 -3.11 0.00 -15.74 0.00 0.00 45.19 3958.98 7.55 S_0001_9019 1 E -81.616 95.109 -180.850 0.000 0.000 0.000 -60.979 -52.601 -70.896 0.000 S_0001_9019 2 E -103.775 140.428 181.156 0.662 1.438 3.457 -61.314 178.939 7.568 0.000 S_0001_9019 3 E -128.914 145.607 180.081 -1.325 0.472 6.551 -62.403 85.133 0.000 0.000 S_0001_9019 ...
Before rescoring ROSETTA full-atom models using the experimental chemical
shifts, it is recommended to extract the models with low ROSETTA energy and
'discard' the 'bad' models with high ROSETTA energy. This expedites further
analysis and can be performed by a simple command line:
extract_lowscore_decoys.py $TAG$PDB_NAME.out N > new_silent_file.out
where the script extract_lowscore_decoys.py (courtesy of whip.bakerlab.org) is used to extract the N lowest-energy models (the energy of a model is defined as the first number in the SCORE line of a silent output file) from a silent file. The output is a new silent output file containing only the selected N lowest-energy models.
If residues in flexible loops are positively identified (e.g., by RCI
analysis), the energy terms for those residues should be excluded from the
ROSETTA full-atom energy. For this purpose, the energy of all models in a
ROSETTA silent output file can be rescored by a script
runRosettaRescore.com and a
command line of:
runRosettaRescore.com $TAG$PDB_NAME.out ref.pdb
which basically runs a single standard ROSETTA command line:
${rosetta} -extract_segment -segments seg.txt -n ref.pdb -s $TAG$PDB_NAME.out -fullatom -fa_input -all -termini
where "ref.pdb" is a reference
PDB coordinate file and required by standard ROSETTA
"-extract_segment" module (the
C-alpha RMSD values relative to this structure will also be calculated during
the re-scoring; for instance, the full atom PDB coordinate file extracted from
the lowest energy ROSETTA model can be used here; see "Full-atom
PDB coordinates extraction"); "seg.txt"
is a text file defining the segment for which ROSETTA will calculate the new
full-atom energy. Here is an example of "seg.txt":
6 60 80 99 120 130
which tells ROSETTA that only residues 6-60, 80-89 and 120-130 are kept and used for calculating the new full-atom energy for all models; this file MUST locate in the current directory. The output is a new ROSETTA silent file with file name of $TAG$PDB_NAME_segment.out.
The script
runCSrescore.com can be used to
apply the chemical shift based "energy-rescoring" for all ROSETTA full-atom
models, using the following command line:
runCSrescore.com silent_file.out inCS.tab
where inCS.tab is the initial experimental chemical shift input file (the same input file used by the script runCSRjob.com for the fragment selection procedure). This script:
extracts full-atom PDB models from the ROSETTA silent output file silent_file.out
for each full-atom PDB model: runs SPARTA chemical shift predictions; calculates the chi2 values between the SPARTA-predicted chemical shifts and the input experimental chemical shifts (stored in inCS.tab); stores the chi2 values as a table file CS_chi2.txt
collects the raw all-atom energies from silent_file.out and generates a table file with name name.rawscore.txt, applies corrections to raw energies using the chemical shift scores collected in (2) and generates a table file with name name.rescore.txt containing the rescored energy information.
calculates the RMSD deviation relative to the model with the lowest re-scored full-atom energy and generates a final output table file with name name.rms.rescore.txt.
Details of each step include:
(1) Full-atom PDB coordinate extraction
To rescore the ROSETTA full-atom models, the
full-atom PDB coordinates are required to be 'extracted' using their full-atom
description encoded in the silent output file, which can be done by using a
script
extract_pdb.com with a command
line such as:
extract_pdb.com silent_file.out
This script actually runs the following ROSETTA
command to generate full-atom PDB coordinates from the information in silent
output file 'silent_file.out':
rosetta -extract -s silent_file.out -fa_input -all -termini -write_atoms_only
Note that the generated PDB coordinates will be
stored in a directory defined in the
paths.txt file. The extracted PDB coordinate files will be named
according to their 'description' labels defined in the silent output.
OUTPUT PATHS: movie ./ pdb ./
(2) Calculate predicted chemical shifts and "chemical shift scores" for ROSETTA full-atom models
The ROSETTA full-atom models are evaluated by
comparing the initial experimental chemical shifts with the SPARTA-predicted
chemical shifts for the models. SPARTA takes the standard PDB coordinate for
proteins and predicts the backbone 15N, 1HN, 1H , 13CA, 13CB and 13C' chemical
shifts using the following command line:
sparta -in inPDB.pdb -ref inCS.tab
where inPDB.pdb contains the input PDB coordinates file, inCS.tab is the input experimental chemical shifts (the same input as used for the MFR fragment search). The output is a file with predicted chemical shifts, and the chi2 value between the predicted and experimental chemical shifts will be also calculated.
The script runCS_rescore.com runs SPARTA chemical shift prediction for all full-atom PDB coordinates generated above, and all outputs will be stored in a default directory "./pred".
(3) Collect energy score and apply correction using chemical shift chi2 value
For each full-atom model, its name and raw ROSETTA
full-atom energy score are extracted from the ROSETTA silent output file
silent_file.out and stored in a
file "name.rawscore.txt". Next,
the energy score will be 'corrected' by using the corresponding chemical shift
chi2 value (stored in file "CS_chi2.txt").
The new file with the model names and re-scored energy will be "name.rescore.txt",
an example of this file contains the following contents:
# name raw_energy chi2 rescore_energy S_0001_9019 -116.07 251.854 -53.1065 S_0002_6198 -124.99 140.1 -89.965 S_0003_5600 -123.80 115.019 -95.0452 S_0004_2308 -118.78 148.107 -81.7533 S_0005_3837 -111.47 75.3417 -92.6346 S_0006_9327 -119.05 110.179 -91.5052 ...
(4) Calculate RMSD values to the lowest energy model
The C_alpha RMSD values between each model and the
model with the lowest re-scored energy are calculated using the script
pdbrms.
pdbrms is a C++ program used to
calculate the coordinate RMSD values between one PDB format structure and a set
of protein PDB coordinates. For example, to calculate the C-alpha RMSD between
ref.pdb and
1.pdb, 2.pdb, 3.pdb, the following command line can be used:
pdbrms ref.pdb 1.pdb 2.pdb 3.pdb
The script
runCSrescore.com will identify the model with the lowest rescored energy,
and calculate the C_alpha RMSD values to this model for all models in the
./output directory. The final
output file "name.rms.rescore.txt"
will contain the model names, C-alpha RMSD values and re-scored energies:
# name rmsd rescored_energy S_0001_9019 1.883 -53.1065 S_0002_6198 1.384 -89.965 S_0003_5600 0.984 -95.0452 S_0004_2308 2.788 -81.7533 S_0005_3837 2.718 -92.6346 S_0006_9327 1.943 -91.5052 ...
By default, the ROSETTA running directory (./rosetta) contains the following contents upon finishing the above CS-ROSETTA protein structure generation:
| aat000_09_05.200_v1_3 | 9-residues fragment input for ROSETTA |
| aat000_09_05.200_v1_3 | 3-residues fragment input for ROSETTA |
| t000_.fasta | FASTA sequence |
| paths.txt | ROSETTA paths definition file |
| runRosetta.com | starting script to run ROSETTA |
| aat000.out | ROSETTA output silent file |
| ./output | Directory for full-atom PDB coordinates |
|
S_*.pdb |
Extracted full-atom PDB coordinates |
|
pred |
Directory for SPARTA chemical shifts prediction summaries |
| name.rawscore.txt | Output table file of model names and raw ROSETTA full-atom energies |
| name.rms.rawscore.txt | Output table file of model names, C_alpha RMSD values (to the lowest raw-energy model) and raw ROSETTA full-atom energies |
| CS_chi2.txt | Output table file of chi2 values calculated between the SPARTA-predicted and experimental chemical shifts for each model |
| name.rescore.txt | Output table file of model names and re-scored ROSETTA full-atom energies |
| name.rms.rescore.txt | Output table file of model names, C_alpha RMSD values (to the lowest rescored-energy model) and re-scored ROSETTA full-atom energies |
| rms2LowRawscore.txt | Output table file for model names and RMSD values relative to the model with the lowest raw energy |
| rms2LowRescore.txt | Output table file of model names and C_alpha RMSD values relative to the model with the lowest re-scored energy |
How to use CS-ROSETTA (with Rosetta3.x)
Using Rosetta 3.x and later versions (also known as mini or miniRosetta) requires different input data and command lines.
Installation of ROSETTA (3.0/3.1)
To install the ROSETTA3.x program, users need to (1) register for a license at http://www.rosettacommons.org/software/, (2) download (at least) the required packages (rosetta3.1_Bundles.tgz and rosetta3.1_fragments.tgz) to the installation directory (for example $ROSETTA_DIR), (3) uncompress rosetta3.1_Bundles.tgz, all four generated sub-packages (with names of rosetta*.tgz) and rosetta3.1_fragments.tgz, (4) go to the rosetta_source directory and type "./scons.py bin mode=release" (for Linux installation) to compile the ROSETTA3.x source codes. After successful compilation, numbers executable ROSETTA files will be generated, links to those files will be found at /rosetta_source/bin/ directory.
The latest version of Rosetta3.1 document is available at: http://www.rosettacommons.org/manuals/archive/rosetta3.1_user_guide.
Setup of ROSETTA (3.0/3.1) in CS-ROSETTA
If ROSETTA3.x is installed in a default way (i.e., with a database directory of $ROSETTA_DIR/rosetta_database, a source directory of $ROSETTA_DIR/rosetta_source and a bin directory of $ROSETTA_DIR/rosetta_source/bin for the links to the compiled executable files), the installation script install.com can be used to install CS-ROSETTA program and automatically setup the ROSETTA3.x in CS-ROSETTA.
Otherwise, the following ROSETTA3.X configuration lines in the initialization script $baseDir/com/csrosettaInit.com have to be manually set up :
setenv rosetta3Dir /home/software/rosetta3.1/
setenv rosetta3 ${rosetta3Dir}/rosetta3_source/bin/AbinitioRelax.linuxgccrelease
setenv rosetta3_extpdbs ${rosetta3Dir}/rosetta3_source/bin/extract_pdbs.linuxgccrelease
setenv rosetta3DB ${rosetta3Dir}/rosetta_database
Fragment selection (runCSRjob3.com)
An additional script runCSRjob3.com is provided to generate MFR fragment inputs for Rosetta3.0/3.1. Use of this script is similar to runCSRjob.com script. The output contains:
9-residues and 3-residues fragment files $TAG$PDB_NAME$CHAIN09.200_R3 and $TAG$PDB_NAME$CHAIN03.200_R3
FASTA sequence file $PDB_NAME$CHAIN.fasta
starting script file runRosetta3.com for ROSETTA3.x structure generation
Structure generation (runRosetta3.com)
The script runRosetta3.com generated in the previous step can be used to run ROSETTA3.x and generate protein structure. Similar to the runRosetta.com script, this script includes solely a standard ROSETTA3.x command line defining the inputs and parameters for fragment assembly and full-atom relaxation.
${rosetta3} -database ${rosetta3DB} -in::file::frag3 $FRAG3_NAME -in::file::frag9
$FRAG9_NAME -in::file::fasta $FASTA_NAME -abinitio::use_filters false -increase_cycles
10 -rsd_wt_helix 0.5 -rsd_wt_loop 0.5 -rg_reweight 0.5 -abinitio::fastrelax -score::weights
score13_env_hb -out::nstruct $N_MODEL -user_tag j001
Note that ROSETTA3.x has different naming method for the generated structures compared to ROSETTA2.x, all ROSETTA3.x structures generated by a given run will be named as S_TAG_AAAAAAAA, where "TAG" is a user defined tag (by "-user_tag" option) and "AAAAAAAA" is a 8-digital index number. Running multiple ROSETTA jobs in parallel for a given project is also different for ROSETTA3.x, users still can run the same script runRosetta3.com for each 'parallel' job in the same working directory, but the -use_tag option MUST be not identical to each other. ROSETTA3.x will still output the structures from each job to a single silent output file (default.out), any two ROSETTA3.x jobs with identical -user_tag option will generate structures with identical name.
Evaluation of CS-ROSETTA models (runCSrescore3.com)
A separated script runCSrescore3.com is provided to evaluate the protein structure generated by ROSETTA3.x. This script can be used in a same manner as the script runCSrescore.com for evaluation of ROSETTA2.x generated structures [see details here]. Note that ROSETTA3.x currently is not able to calculate the energy scores for part of the protein, so the final chemical shift rescored ROSETTA(3.x) energy will be calculated based on the ROSETTA(3.x) raw energy of all residues.
How to select CS-ROSETTA models
Criteria for convergence and accepting models
After finishing CS-ROSETTA structure generation, users have to decide whether the ROSETTA models are acceptable. For this purpose, it is convenient to plot the "landscape" of (re-scored) ROSETTA full-atom energies of all models with respect to their C_alpha RMSD values relative to the lowest-energy model, using the data stored in a file "name.rms.rescore.txt".


By using the current method implemented in CS-ROSETTA package, 5,000 to 20,000 predicted CS-ROSETTA models are generally required to obtain convergence. For small proteins (<= 90-100 amino acids), 1,000 to 5,000 CS-ROSETTA models often suffice. ROSETTA takes about 5-10 minutes to calculate one all-atom model on a single 2.4GHz CPU.
How to use CS-ROSETTA for symmetric homomultimers
As described in the paper:
Simultaneous prediction of protein folding and docking at high resolution
Rhiju Das et al.,
Proc Natl Acad
Sci USA, (2009) Early Edition
ROSETTA now can apply the simultaneous prediction of protein folding and docking for symmetric homomultimers. CS-ROSETTA is updated to provide an interface to use this "fold-and-dock" feature (currently only available in ROSETTA 2.3.0) and generate structures for (small) home-dimers and home-tetramer from their chemical shifts.
Fragment selection
The script runCSRjob.com is updated to generate fragment inputs and prepare ROSETTA running script for folding and docking a symmetric homomultimer, An newly added option $SYMM in the runCSRjob.com script must to be firstly defined according to the symmetry of the homomultimer to be modeled:
set SYMM = "C2" # for a C2 homodimer set SYMM = "C4" # for a C4 homotetramer set SYMM = "D2" # for a D2 homotetramer
The output contains:
9-residues and 3-residues fragment files $TAG$PDB_NAME$CHAIN09_05.200_v1_3 and $TAG$PDB_NAME$CHAIN03_05.200_v1_3
FASTA sequence file $PDB_NAME$CHAIN.fasta
ROSETTA paths definition file paths.txt
starting script file runRosetta.FnD.$SYMM.com for ROSETTA structure generation
Structure generation (runRosetta.FnD.$SYMM.com)
The script runRosetta.FnD.$SYMM.com generated in the previous step can be used to run ROSETTA 2.3.0 and generate structure for homomultimers.
The ROSETTA "folding-and-docking" procedure is more computationally demanding (on the order of hours per model for small homomultimers).
The following steps of chemical shift rescoring and model selection are similar to those of the CS-ROSETTA runs for a monomeric protein.
| Why no (or no sufficient, i.e., <200) fragment candidates
obtained after MFR fragment search using runCSRjob.com? Answer
|
|
How to exclude some proteins from the structural database during the fragment search? Answer
|
|
|
During the Rosetta parallel jobs, how to avoid the same results (ROSETTA models)
assembled from using the identical random seed numbers?
Answer
|